Example: marketing

HAL EHWAL CUTI - moh.gov.bn

OUR VALUES . client first . together . excellence . dynamic . HAL EHWAL CUTI JABATAN PENTADBIRAN DAN KEWANGAN KEMENTERIAN KESIHATAN

Tags:

  Kewangan

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Text of HAL EHWAL CUTI - moh.gov.bn

OUR VALUES . client first . together . excellence . dynamic . HAL EHWAL CUTIJABATAN PENTADBIRAN DAN KEWANGANKEMENTERIAN KESIHATANOUR VALUES . client first . together . excellence . dynamic . JENIS-JENIS CUTI CutiTahunan CutiMandatori CutiLebihMasa (Off In Lieu) CutiTanpaCatat CutiKhasMenunaikanFardhuHaji CutiKhasMenemaniSuami/ IsteriBertugasDi LuarNegeri CutiSakit CutiBeranak CutiTidakBergaji CutiMenemaniPesakit CutiSakitDisahkanSendiri(CSDS)OUR VALUES . client first . together . excellence . dynamic . CUTI TAHUNANOUR VALUES . client first . together . excellence . dynamic . KELAYAKAN CUTIBagipenjawatawamdalamperkhidmatantet ap:BAHAGIANUMURKELAYAKANI danIIDi bawah4042 hari40 & keatas50 hariIIIDi bawah4026 hari40 & keatas34 hariIVDi bawah4024 hari40 & keatas30 hariVDi bawah4022 hari40 & keatas27 hariOUR VALUES . client first . together . excellence . dynamic . KELAYAKAN CUTIBagipenjawatawamdalamperkhidmatangaj ihari:KELAMAAN PERKHIDMATANKELAYAKANKurang1 tahunTidakadahakcuti1 7 tahun7 hari8 14 tahun10 hari15 tahunkeatas14 hariOUR VALUES . client first . together . excellence . dynamic . TIADA KELAYAKAN CUTI TAHUNANTerdapatbeberapakeadaandimanapara pegawaitidakakanmendapatkelayakancutitah unan: Cutiberanak Cutitidakbergaji Cutikhasmenemanipesakitdiluarnegeribagip egawaiyangmengambilcutitidakbergaji Cutimenunaikanfardhuhaji LatihanDalamPerkhidmatanDalamdanLuarNege ri(bagitempoh31haridankeatas) DiambilTindakanTatatertibOUR VALUES . client first . together . excellence . dynamic . PENGAMBILAN CUTI TAHUNAN BAGI PEGAWAI YANG BARU BERKHIDMAT Pegawai-pegawaiyangbaruberkhidmatbolehme ngambilcutitahunansetelahberkhidmatselam asatu(1)bulankalendardengankadarkelayaka nmasing-masing Pegawai-pegawaiyangbaruberkhidmat,tidakl agiperlumenunggusehinggaperkhidmatannyam encapaiduabelas(12)bulanuntukmendapatkel ayakancuti Pegawai-pegawaiinihanyaperluberkhidmatsa tu(1)bulankalendaruntukmendapatkelayakan cutiOUR VALUES . client first . together . excellence . dynamic . CUTI MANDATORIOUR VALUES . client first . together . excellence . dynamic . Cutiselamaempatbelas(14)haribagisetiapsa tu(1)tahunperkhidmatan Kelayakan:BahagianI,IIdanIII Jikacutiinitidakdiambildalamjangkamasaya ngditetapkanataumelebihi12bulanulangtahu nlantikannya,makaianyaakandikiramansuhda nakanditolakdarijumlahkelayakancutitahun anOUR VALUES . client first . together . excellence . dynamic . PENGAMBILAN CUTI TAHUNAN DAN CUTI MANDATORI Cutitahunandancutimandatoriyangdiambilad alahtermasuk: Haribekerja Harikelepasanam HarikelepasanawamOUR VALUES . client first . together . excellence . dynamic . PENGAMBILAN CUTI SETERUSNYA Pegawai-pegawaiyangbarukembalibertugasse lepasbercutidikehendakiuntukberkhidmatse lama30haridaritarikhterakhircutinyasebel ummengambilcutiseterusnyaOUR VALUES . client first . together . excellence . dynamic . KADAR MAKSIMUM BAKI CUTI BagisemuapegawaididalamBahagianIhinggaV, kadarmaksimumbakicutiyangterkumpulpadabi la-bilamasaadalahsebanyak108hari Jikacutiseseorangpegawaiitumelebihi108ha ri,cutiyangberlebihanituakanhilangBakicu tisebenar= 110 hariKadar maksimumyang dibenarkan= 108 hariCutiyang hilang= 110 108 = 2 hariOUR VALUES . client first . together . excellence . dynamic . CUTI LEBIH MASA(OFF IN LIEU)OUR VALUES . client first . together . excellence . dynamic . Diberikanuntukmenggantikanwaktubekerjale bihmasa(overtime) Kelayakan:BahagianIII,IVdanVsertapekerja bergajihari Kadar:Tujuh(7)harisetahunOUR VALUES . client first . together . excellence . dynamic . CUTI TANPA CATATOUR VALUES . client first . together . excellence . dynamic . Hanyadiberikankepadapegawaiperkhidmatana wamyangmenyertaikegiatan-kegiatanberikut : Mewakilinegaramelaluiacarakeagamaan Mewakilinegaramelaluiacarasukanatauolahr aga Mewakilinegaraatasurusanbelia Mewakilinegaramelaluiacarakebudayaan Mewakilinegaramelaluiacarakemasyarakatan Menghadirimesyuarat,seminar,simposiumdan persatuan-persatuanyangdiiktirafolehkera jaanOUR VALUES . client first . together . excellence . dynamic . Cutiinitidakakanditolakdarikelayakancuti tahunan Hendaklahterlebihdahulumendapatsokongand aripadakementerianyangberkenaan KebenarandaripadaKetuaJabatandanseterusn yamendapatkebenarandaripadaKetuaPengarah PerkhidmatanAwamOUR VALUES . client first . together . excellence . dynamic . CUTI KHAS MENUNAIKAN FARDHU HAJIOUR VALUES . client first . together . excellence . dynamic . Diberikankepadapegawai-pegawaiyangdiberi pengurniaantambangmenunaikanfardhuhajiol ehkerajaan Memulakancutidua(2)harisebelumbertolakke ArabSaudidandua(2)harisesudahsampaidiNeg araBruneiDarussalamOUR VALUES . client first . together . excellence . dynamic . CUTI KHAS MENEMANI SUAMI/ISTERI BERTUGAS DI LUAR NEGERIOUR VALUES . client first . together . excellence . dynamic . Diberikanuntukmenemanisuamiatauisteriyan gbertugasdiluarnegeri Ketikapengambilancutiini,gajisertaelaun- elaundiberhentikan Bagaimanapun,kenaikantahunantetapberjala ndantempohperkhidmatandengankerajaandisa mbungOUR VALUES . client first . together . excellence . dynamic . CUTI SAKITOUR VALUES . client first . together . excellence . dynamic . Sijilcutisakit(MC)yangdisahkanolehdoktor darirumahsakitKerajaan,JPMCatauHospitalP anaga (jikamelebihi,ditolakdaribakicutitahunan ) Pegawaiyangbergajiharidiberikansebanyak1 4haricutisakitdalamtempohperkhidmatanset ahun,OUR VALUES . client first . together . excellence . dynamic . CUTI BERANAKOUR VALUES . client first . together . excellence . dynamic . Diberikankepadapegawaidankakitanganperem puandidalamPerkhidmatanAwamyangsahberkah windisisiUndang-UndangNegaraBruneiDaruss alam Kadar:105hari(hendaklahdiambil2mingguseb elumtarikhdijangkabersalin) Dalamtempohcutiberanak,tidakakanmendapat kelayakancutitahunanOUR VALUES . client first . together . excellence . dynamic . PERATURAN CUTI BERANAK Cutitersebutdisahkanolehpegawaiperubatan kerajaan Cutibersalinhandaklahdihabiskandidalamne gerisahaja,kecuali: JikabertugasdiluarNegaraBruneiDarussalam TerpaksamelahirkandiluarNegaraBruneiDaru ssalam Terpaksamendapatrawatanselepasbersalindi luarNegaraBruneiDarussalamOUR VALUES . client first . together . excellence . dynamic . PENENTUAN PEMBAYARAN GAJI Pembayarangajipegawaiataukakitanganwanit ayangmengambilcutiberanakadalahberdasark antempohperkhidmatannya:TEMPOH PERKHIDMATANPEMBAYARAN GAJIMelebihi180 hariGajipenuh90 hingga180 hariSeparuhgajiKurang90 hariTidakbergajiOUR VALUES . client first . together . excellence . dynamic . CUTI TIDAK BERGAJIOUR VALUES . client first . together . excellence . dynamic . PermohonanCTBhanyadipertimbangkanbagipeg awaiyangtidakmempunyaikelayakancutiseper ti: Pegawaiyangkehabisancuti Pegawaiyangmemangtidakadakelayakancutise pertiguru-guru CTBmengakibatkanterjejasnyacutitahunan,t empohperkhidmatan,pembayarangaji,bonus,e laun-elaun,tarikhkenaikangajitahunan,pen cen,baksis,TAP CTByangmelebihi30harihendaklahmendapatke benarandaripadaKetuaPengarahPerkhidmatan AwamOUR VALUES . client first . together . excellence . dynamic . CUTI MENEMANI PESAKITOUR VALUES . client first . together . excellence . dynamic . Menggunakanbakicutitahunan Jikabakicutitidakmencukupi,diberikancuti pendahuluan Cutipendahuluanyangdiberikanadalahmenuru thakkelayakancutitahunan12bulancalendars eorangpegawaiitu Cutitidakbergajiakandiberikanjikatempohb ercutimelebihikelayakancutitahunanOUR VALUES . client first . together . excellence . dynamic . CUTI SAKIT DISAHKAN SENDIRI (CSDS)OUR VALUES . client first . together . excellence . dynamic . Cutisakitbagipenyakitringanyangdiambilse ndiritanpamemerlukansijilcutisakitdaripa daPegawaiPerubatanKerajaanatauklinik-kli nikswastayangdiiktiraf. Sakityangtidakmenyebabkankesanperubatany angberpanjangan;atau, Sakityangmempunyairisikoyangrendahdalamm enyebabkankomplikasidanketidakselesaan(i nconvenience)kepadapenghidapnya;atau,DEF INISI CUTI SAKIT DISAHKAN SENDIRI (CSDS)OUR VALUES . client first . together . excellence . dynamic . ,ianyaadalahuntukmemberikankelegaandarip adakesanpenyakittersebut. VALUES . client first . together . excellence . dynamic . TempohCSDSadalahselamaenam(6)haridalamsa tu(1)tempohperkhidmatandanditolakdaripad ahakcutitahunanataucutitanpagajijikatida kadahakcuti. CSDStidakbolehdiambilmelebihidua(2)harib erturut-turut,termasukharikelepasanam, AMOUR VALUES . client first . together . excellence . dynamic . SemuaPegawaidanKakitanganwargaperkhidmat anawamdarikesemuaBahagiandankesemuajawat antermasukyangberjawatantetap,sebulankes ebulan,berkontra, KELAYAKANOUR VALUES . client first . together . excellence . dynamic . JikaCSDStelahhabisdigunakaniaituselamaen am(6)haridalamsatu(1)tahuntempohperkhidm atan,sijilcutisakitadalahdiperlukan. JikaCSDSdiambilmelebihidua(2)hariberturu t-turut,sijilcutisakitbagihariketigadans eterusnyaadalahdiperlukan. VALUES . client first . together . excellence . dynamic . SemasaCSDS,Pegawai-PegawaidanKakitangant idakdibenarkankeluarnegeri. BagiPegawai-PegawaidanKakitanganyangbera dadiluarnegeridanjatuhsakitadalahtidakdi benarkanmengambilCSDS. VALUES . client first . together . excellence . dynamic . PadaawalpengenalanperaturanCSDSini, SECARA PRO-RATAOUR VALUES . client first . together . excellence . dynamic . Contoh:Jikatarikhulangtahunperkhidmatans eorangpegawaiialahpadasetiap02Mac,perkir aankelayakanCSDSdari01September2016hingg a02Mac2017adalahsepertiberikut:01/09/201 6hingga30/09/2016 1bulan01/10/2016 hingga 31/10/2016 2 bulan01/11/2016 hingga 30/11/2016 3 bulan01/12/2016 hingga 31/12/2016 4 bulan01/01/2017 hingga 31/01/2017 5 bulan01/02/2017 hingga 28/02/2017 6 bulan01/03/2017September2016hinggaFeb201 7=6bulan6bulanX6hari(CSDS)=3hari12BulanC ONTOH PERKIRAAN SECARA PRO-RATAOUR VALUES . client first . together . excellence . dynamic . KelayakanCSDSdari01September2016hingga02 Mac2017=3hari JikaCSDSselama3hariinitelahhabisdigunaka nsebelum02Mac2017,makapegawaitersebutmes tilahmemohonsijilcutisakitdaripegawaiper ubatansekiranyaianyajatuhsakitdanmemerlu kancuti. PegawaihanyaakandiberikankelayakanCSDSse lamaenam(6)harimulai02Mac2017hingga01Mac 2018,iaitusatu(1) PERKIRAAN SECARA PRO-RATAOUR VALUES . client first . together . excellence . dynamic . MemaklumkanKetuaJabatan/Bahagian/Unitmel aluitelefonDANpesananringkas(SMS) ,PegawaidanKakitanganberkenaanbolehdiang gaptidakhadirbekerjatanpakebenaranatauta npasebab. PERMOHONANOUR VALUES . client first . together . excellence . dynamic . MengisiborangpermohonanCSDSmelaluiGEMSat auborangJabatansebaik-baiksahajakembalib ertugas. PermohonanhendaklahdisahkanolehKetuaJaba tan/Bahagian/Unitsekiranyaianyasudahdibe rikankebenaranmelaluitelefondanSMSataupu nmana-manaaplikasiperhubungan. CSDShendaklahdicatatdalampenyatacuti. PERMOHONAN